PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.0799s0018.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family TALE
Protein Properties Length: 290aa    MW: 32813.2 Da    PI: 5.6621
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.0799s0018.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox314.3e-102202581854
                          HHHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
             Homeobox  18 lFek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                          lF+   ++yp+++e+  LA+++gL+++qV++WF N R +
  Cagra.0799s0018.1.p 220 LFQHflHPYPNEAEKLVLASQTGLSKNQVSNWFINARVR 258
                          5775569******************************98 PP

2BELL102.43.3e-3381152172
                 BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                          e++e+++k++kLlsll++V++r+  y++ql++vissFe++ag gs+k+Yt lAl+a++rhF +L++ai++q+
  Cagra.0799s0018.1.p  81 ENHEIHIKITKLLSLLQQVEERFDMYCNQLEQVISSFEEIAGDGSSKVYTGLALQAMTRHFGSLEEAIISQL 152
                          689******************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.7E-1111150IPR006563POX domain
PfamPF075262.1E-2917148IPR006563POX domain
SMARTSM003899.7E-10202266IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.4E-27207268IPR009057Homeodomain-like
CDDcd000864.19E-11208263No hitNo description
SuperFamilySSF466894.28E-18208271IPR009057Homeodomain-like
PfamPF059201.8E-17219258IPR008422Homeobox KN domain
PROSITE profilePS5007111.791221262IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 290 aa     Download sequence    Send to blast
MDEFRARHEC SSLRGTLLDS RYAKAVQCLV EEVIDIGGRD VELCNDILIQ QMFPGRRRSG  60
FGLSSEIKSE LCSAGFMSLP ENHEIHIKIT KLLSLLQQVE ERFDMYCNQL EQVISSFEEI  120
AGDGSSKVYT GLALQAMTRH FGSLEEAIIS QLNSVRRRFI ISQQDVPKII SSGLSQLSLF  180
DGNTSSSLQR LGLVQGPQRH AWKPIRGLPE TSVAILRAWL FQHFLHPYPN EAEKLVLASQ  240
TGLSKNQVSN WFINARVRLW KPMIEEMYRE EFGDSSDESM QREANDDSN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A6e-18208269566Homeobox protein Meis2
3k2a_B6e-18208269566Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ4464320.0DQ446432.1 Arabidopsis thaliana clone pENTR221-At1g75430 homeodomain-containing protein (At1g75430) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006301007.10.0hypothetical protein CARUB_v10021397mg
SwissprotQ1PFD10.0BLH11_ARATH; BEL1-like homeodomain protein 11
TrEMBLR0I7660.0R0I766_9BRAS; Uncharacterized protein
STRINGAl_scaffold_0002_22470.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM97362734
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75430.10.0BEL1-like homeodomain 11